RP11-298P3.3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RP11-298P3.3

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: TSCSLGVTSDFHFLNERFDRKLKRWEEPKELPAEDSQDLTSTDYRSLELP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NEDD4-binding protein 2-like 2

Protein Size: 752

Purification: Affinity Purified

• Artikelnummer: AVIARP55407_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55407_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10443
• Wirt: Rabbit