RP2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefo

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RP2

Key Reference: Grimwood,J., (2004) Nature 428 (6982), 529-535

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein XRP2

Protein Size: 350

Purification: Affinity Purified

• Artikelnummer: AVIARP56724_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56724_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 6102
• Wirt: Rabbit