RPA4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. RPA4 is the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. Replication protein A (RPA) is an essential factor for DNA double-strand break repair and cell cycle checkpoint activation. This gene encodes the 32-kDa subunit of the RPA, which associates with the 70- and 13-kDa subunits to form a trimeric RPA complex. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1448 BC069824.1 1-1448

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPA4

Key Reference: Wu,X., Biochem. J. 391 (PT 3), 473-480 (2005)

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Replication protein A 30 kDa subunit

Protein Size: 261

Purification: Affinity Purified

• Artikelnummer: AVIARP54941_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54941_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 29935
• Wirt: Rabbit