RPE Antibody - N-terminal region : HRP

RPE Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56726_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPE

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Putative uncharacterized protein RPE EMBL AAX93087.1

Protein Size: 178

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56726_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56726_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 6120
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×