RPL13A Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPL13A

Key Reference: Hasegawa,K., (2008) Biochem. Biophys. Res. Commun. 372 (1), 51-56

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 60S ribosomal protein L13a

Protein Size: 203

Purification: Affinity Purified

• Artikelnummer: AVIARP58522_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58522_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23521
• Wirt: Rabbit
• Konjugat: Conjugated, HRP