Rpl17 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Rpl17 is a component of the 60S subunit of the ribosome, the organelles that catalyze protein synthesis; member of the L22P family of ribosomal proteins; induced under amino acid deprivation of cells.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rpl17

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: APKMRRRTYRAHGRINPYMSSPCHIEMILTEKEQIVPKPEEEVAQKKKIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 60S ribosomal protein L17

Protein Size: 184

Purification: Affinity Purified

• Artikelnummer: AVIARP56130_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56130_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 291434
• Wirt: Rabbit