RPS27L Antibody - N-terminal region : Biotin

RPS27L Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56775_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPS27L

Key Reference: Goto,Y., (2006) FEBS Lett. 580 (7), 1833-1838

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 40S ribosomal protein S27-like

Protein Size: 84

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56775_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56775_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51065
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×