Rps6ka2 Antibody - C-terminal region : FITC

Rps6ka2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56169_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Rps6ka2 is a serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of transcription factors, regulates translation, and mediates cellular proliferation, survival, and differentiation. May function as tumor suppressor in epithelial ovarian cancer cells.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rps6ka2

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: KMLHVDPQQRLTAVQVLKHPWIVNREYLSQNQLSRQDVHLVKGAMAATYF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ribosomal protein S6 kinase alpha-2

Protein Size: 733

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56169_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56169_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 20112
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×