RPS6KB1 Antibody - N-terminal region : HRP

RPS6KB1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56553_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPS6KB1

Key Reference: Ma,X.M., (2008) Cell 133 (2), 303-313

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ribosomal protein S6 kinase beta-1

Protein Size: 525

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56553_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56553_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6198
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×