Rras Antibody - C-terminal region : FITC

Rras Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56712_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Rras regulates the organization of the actin cytoskeleton

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Rras

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: ASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRKYQEQELPPSPPSAP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein R-Ras

Protein Size: 218

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56712_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56712_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 361568
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×