RSBN1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RSBN1

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: GGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Round spermatid basic protein 1

Protein Size: 802

Purification: Affinity Purified

• Artikelnummer: AVIARP57221_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57221_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54665
• Wirt: Rabbit