SCRN2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of SCRN2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCRN2

Key Reference: Way,G., (2002) Mol. Biol. Cell 13 (9), 3344-3354

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Secernin-2

Protein Size: 425

Purification: Affinity Purified

• Artikelnummer: AVIARP58525_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58525_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 90507
• Wirt: Rabbit
• Konjugat: Conjugated, FITC