English
SDCBP2 Antibody - N-terminal region : FITC
SDCBP2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55326_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SDCBP2
Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871
Molecular Weight: 23kDa
Peptide Sequence: Synthetic peptide located within the following region: VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Syntenin-2
Protein Size: 207
Purification: Affinity Purified
Description of Target: SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SDCBP2
Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871
Molecular Weight: 23kDa
Peptide Sequence: Synthetic peptide located within the following region: VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Syntenin-2
Protein Size: 207
Purification: Affinity Purified
| Artikelnummer | AVIARP55326_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55326_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 27111 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
