SDCBP2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SDCBP2 contains 2 PDZ (DHR) domains. The function of SDCBP2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SDCBP2

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: VAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Syntenin-2

Protein Size: 207

Purification: Affinity Purified

• Artikelnummer: AVIARP55326_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55326_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 27111
• Wirt: Rabbit