SELE Antibody - N-terminal region : Biotin

SELE Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP59109_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SELE

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: WVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E-selectin

Protein Size: 610

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59109_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59109_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6401
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×