SENP5 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SENP5

Key Reference: Gong,L. (2006) J. Biol. Chem. 281 (23), 15869-15877

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sentrin-specific protease 5

Protein Size: 755

Purification: Affinity Purified

• Artikelnummer: AVIARP55489_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55489_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 205564
• Wirt: Rabbit