English
SERHL2 Antibody - C-terminal region : HRP
SERHL2 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP58657_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEHL2
Key Reference: N/A
Molecular Weight: 34kDa
Peptide Sequence: Synthetic peptide located within the following region: LLQRLLKSNSHLSEECGELLLQRGTTKVATGLVLNRDQRLAWAENSIDFI
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: serine hydrolase-like protein 2
Protein Size: 314
Purification: Affinity purified
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEHL2
Key Reference: N/A
Molecular Weight: 34kDa
Peptide Sequence: Synthetic peptide located within the following region: LLQRLLKSNSHLSEECGELLLQRGTTKVATGLVLNRDQRLAWAENSIDFI
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: serine hydrolase-like protein 2
Protein Size: 314
Purification: Affinity purified
| Artikelnummer | AVIARP58657_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58657_P050-HRP |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 253190 |
| Wirt | Rabbit |
| Konjugat | Conjugated, HRP |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
