SERINC2 Antibody - middle region : FITC

SERINC2 Antibody - middle region : FITC
Artikelnummer
AVIARP55790_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERINC2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: SSIPEQKCNPHLPTQLGNETVVAGPEGYETQWWDAPSIVGLIIFLLCTLF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine incorporator 2

Protein Size: 455

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55790_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55790_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 347735
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×