SERPINB12 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: LGMVRLGARSDSAHQIDEVLHFNEFSQNESKEPDPCLKSNKQKAGSLNNE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serpin B12

Protein Size: 405

Purification: Affinity Purified

• Artikelnummer: AVIARP59168_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59168_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 89777
• Wirt: Rabbit
• Konjugat: Conjugated, FITC