SERPINB13 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: SERPINB13 may play a role in the proliferation or differentiation of keratinocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINB13

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: MVYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serpin B13

Protein Size: 391

Purification: Affinity Purified

• Artikelnummer: AVIARP59171_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59171_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5275
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin