English
SET Antibody - N-terminal region : Biotin
SET Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56542_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-indu
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SET
Key Reference: Liu,Z., (2008) Mol. Cell 29 (6), 665-678
Molecular Weight: 32kDa
Peptide Sequence: Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: cDNA, FLJ96345, Homo sapiens SET translocation (myeloid leukemia-associated) (SET),mRNA EMBL BAG37717.1
Protein Size: 277
Purification: Affinity Purified
Description of Target: SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1. In the course of cytotoxic T-lymphocyte (CTL)-indu
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SET
Key Reference: Liu,Z., (2008) Mol. Cell 29 (6), 665-678
Molecular Weight: 32kDa
Peptide Sequence: Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: cDNA, FLJ96345, Homo sapiens SET translocation (myeloid leukemia-associated) (SET),mRNA EMBL BAG37717.1
Protein Size: 277
Purification: Affinity Purified
| Artikelnummer | AVIARP56542_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56542_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Immunoprecipitation, Western Blotting, Immunohistochemistry |
| Human Gene ID | 6418 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
