SFN Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SFN

Key Reference: Yang,W., (2008) Cell Cycle 7 (5), 670-682

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 14-3-3 protein sigma

Protein Size: 248

Purification: Affinity Purified

• Artikelnummer: AVIARP54792_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54792_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 2810
• Wirt: Rabbit