SFRS7 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SFRS7

Key Reference: Swartz,J.E., (2007) J. Biol. Chem. 282 (27), 19844-19853

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/arginine-rich splicing factor 7

Protein Size: 238

Purification: Affinity Purified

• Artikelnummer: AVIARP56231_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56231_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6432
• Wirt: Rabbit