SGK1 Antibody - C-terminal region : FITC

SGK1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP56653_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human SGK1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: GAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: serine/threonine-protein kinase Sgk1

Protein Size: 387

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56653_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56653_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6446
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×