SGK3 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SGK3

Key Reference: Slagsvold,T., (2006) EMBO J. 25 (16), 3738-3749

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 464

Purification: Affinity Purified

• Artikelnummer: AVIARP55612_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55612_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 23678
• Wirt: Rabbit