SH3GL1 Antibody - N-terminal region : HRP

SH3GL1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56547_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SH3GL1 is implicated in endocytosis. It may recruit other proteins to membranes with high curvature.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3GL1

Key Reference: Ralser,M., (2005) Hum. Mol. Genet. 14 (19), 2893-2909

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Endophilin-A2

Protein Size: 368

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56547_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56547_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6455
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×