SH3GL2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SH3GL2 is implicated in synaptic vesicle endocytosis. SH3GL2 may recruit other proteins to membranes with high curvature.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3GL2

Key Reference: Sinha,S., (2008) Ann. Surg. Oncol. 15 (4), 1070-1080

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endophilin-A1

Protein Size: 352

Purification: Affinity Purified

• Artikelnummer: AVIARP56549_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56549_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6456
• Wirt: Rabbit