Sh3glb1 Antibody - N-terminal region : FITC

Sh3glb1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58875_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Sh3glb1 may be required for normal outer mitochondrial membrane dynamics. It is required for coatomer-mediated retrograde transport in certain cells. It may recruit other proteins to membranes with high curvature. It may promote membrane fusion.

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: KIMKQTEVLLQPNPNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Endophilin-B1

Protein Size: 365

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58875_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58875_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54673
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×