Sh3kbp1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Sh3kbp1 binds apoptosis-linked gene 2 (ALG-2) interacting protein 1; involved in regulation of apoptosis in astrocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Sh3kbp1

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: QSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSRTVTISQVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH3-domain kinase binding protein 1 EMBL AAH70877.1

Protein Size: 665

Purification: Affinity Purified

• Artikelnummer: AVIARP54454_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54454_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 84357
• Wirt: Rabbit