English
SH3KBP1 Antibody - N-terminal region : FITC
SH3KBP1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54453_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: This gene encodes an adapter protein that contains three N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3KBP1
Molecular Weight: 68
Peptide Sequence: Synthetic peptide located within the following region: TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: SH3 domain-containing kinase-binding protein 1
Protein Size: 628
Purification: Affinity Purified
Description of Target: This gene encodes an adapter protein that contains three N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3KBP1
Molecular Weight: 68
Peptide Sequence: Synthetic peptide located within the following region: TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: SH3 domain-containing kinase-binding protein 1
Protein Size: 628
Purification: Affinity Purified
| Artikelnummer | AVIARP54453_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54453_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting, Immunohistochemistry |
| Human Gene ID | 30011 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
