English
SHB Antibody - N-terminal region : Biotin
SHB Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58763_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHB
Key Reference: Kriz,V., (2006) J. Biol. Chem. 281 (45), 34484-34491
Molecular Weight: 55kDa
Peptide Sequence: Synthetic peptide located within the following region: ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: SH2 domain-containing adapter protein B
Protein Size: 509
Purification: Affinity Purified
Description of Target: SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. SHB may also regulate IRS1 and IRS2 signaling in insulin-producing cells.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHB
Key Reference: Kriz,V., (2006) J. Biol. Chem. 281 (45), 34484-34491
Molecular Weight: 55kDa
Peptide Sequence: Synthetic peptide located within the following region: ERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAY
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: SH2 domain-containing adapter protein B
Protein Size: 509
Purification: Affinity Purified
| Artikelnummer | AVIARP58763_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58763_P050-Biotin |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 6461 |
| Wirt | Rabbit |
| Konjugat | Conjugated, Biotin |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
