SHB Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. SHB may also play a rol

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHB

Key Reference: Kriz,V., (2006) J. Biol. Chem. 281 (45), 34484-34491

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SH2 domain-containing adapter protein B

Protein Size: 509

Purification: Affinity Purified

• Artikelnummer: AVIARP58762_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58762_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6461
• Wirt: Rabbit
• Konjugat: Conjugated, FITC