SHC3 Antibody - middle region : HRP

SHC3 Antibody - middle region : HRP
Artikelnummer
AVIARP56958_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: SHC3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. SHC3 is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SHC3

Key Reference: Villanacci,V., (2008) Neurogastroenterol. Motil. 20 (3), 206-212

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: SHC-transforming protein 3

Protein Size: 594

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56958_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56958_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 53358
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×