Shc3 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Shc3 is a signaling adapter that couples activated growth factor receptors to signaling pathway in neurons. It is involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: PSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSIS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: SHC-transforming protein 3

Protein Size: 474

Purification: Affinity Purified

• Artikelnummer: AVIARP56957_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56957_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 20418
• Wirt: Rabbit