SHLD2 Antibody - C-terminal region : FITC

SHLD2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57322_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM35A

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: SSEITYGMVVADLFHSLLAVSAEPCVLKIQSLFVLDENSYPLQQDFSLLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: shieldin complex subunit 2; protein FAM35A

Protein Size: 835

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57322_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57322_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54537
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×