SIPA1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SIPA1

Key Reference: Lee,Y.J., (2008) Int. J. Dev. Biol. 52 (1), 43-53

Molecular Weight: 112kDa

Peptide Sequence: Synthetic peptide located within the following region: TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Signal-induced proliferation-associated protein 1

Protein Size: 1042

Purification: Affinity Purified

• Artikelnummer: AVIARP58780_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58780_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6494
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin