Ska1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ska1 is a Component of the SKA1 complex, a microtubule-binding subcomplex of the outer kinetochore that is essential for proper chromosome segregation. It is required for timely anaphase onset during mitosis, when chromosomes undergo bipolar attachment on spindle microtubules leading to silencing of the spindle checkpoint. The SKA1 complex is a direct component of the kinetochore-microtubule interface and directly associates with microtubules as oligomeric assemblies. The complex facilitates the processive movement of microspheres along a microtubule in a depolymerization-coupled manner. In the complex, it mediates the interaction with microtubules.

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LLNKFELEIQYQEQTNSSLKELCESLREECEDVEHLKEHVPPHLPQVTAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spindle and kinetochore-associated protein 1

Protein Size: 254

Purification: Affinity Purified

• Artikelnummer: AVIARP55460_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55460_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 66468
• Wirt: Rabbit