Slc9a7 Antibody - C-terminal region : Biotin

Slc9a7 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP58392_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Slc9a7 mediates electroneutral exchange of protons for Na+ and K+ across endomembranes. It may contribute to Golgi volume and cation homeostasis.

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSYTASTSLECGRRTKSSSEEVLERDLGMGDQKVSSRGTPLVFPLQENA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sodium/hydrogen exchanger 7

Protein Size: 726

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58392_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58392_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 236727
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×