Slc9a7 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Slc9a7 mediates electroneutral exchange of protons for Na+ and K+ across endomembranes. It may contribute to Golgi volume and cation homeostasis.

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSYTASTSLECGRRTKSSSEEVLERDLGMGDQKVSSRGTPLVFPLQENA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sodium/hydrogen exchanger 7

Protein Size: 726

Purification: Affinity Purified

• Artikelnummer: AVIARP58392_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58392_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 236727
• Wirt: Rabbit
• Konjugat: Conjugated, HRP