SLIT3 Antibody - N-terminal region : Biotin

SLIT3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58766_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLIT3

Key Reference: Lin,L. (2006) Stem Cells 24 (11), 2504-2513

Molecular Weight: 168kDa

Peptide Sequence: Synthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Slit homolog 3 protein

Protein Size: 1523

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58766_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58766_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6586
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×