SLIT3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLIT3

Key Reference: Lin,L. (2006) Stem Cells 24 (11), 2504-2513

Molecular Weight: 168kDa

Peptide Sequence: Synthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Slit homolog 3 protein

Protein Size: 1523

Purification: Affinity Purified

• Artikelnummer: AVIARP58766_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58766_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6586
• Wirt: Rabbit
• Konjugat: Conjugated, FITC