SNAG1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a SH3 domain. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SNAG1

Molecular Weight: 69kDa

Peptide Sequence: Synthetic peptide located within the following region: AIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sorting nexin-18

Protein Size: 624

Purification: Affinity Purified

• Artikelnummer: AVIARP58952_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58952_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 112574
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin