Sntg1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Sntg1 is an adapter protein that binds to and probably organizes the subcellular localization of a variety of proteins. It may link various receptors to the actin cytoskeleton and the dystrophin glycoprotein complex. It may participate in regulating the subcellular location of diacylglycerol kinase-zeta to ensure that diacylglycerol is rapidly inactivated following receptor activation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: KLPVNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Gamma-1-syntrophin

Protein Size: 517

Purification: Affinity Purified

• Artikelnummer: AVIARP57299_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57299_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 71096
• Wirt: Rabbit