Snx10 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Snx10 may be involved in several stages of intracellular trafficking. May play a role in endosome homeostasis. Overexpression causes formation of huge vacuoles.

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: DFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sorting nexin-10

Protein Size: 201

Purification: Affinity Purified

• Artikelnummer: AVIARP54936_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54936_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 71982
• Wirt: Rabbit