SNX5 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: SNX5 is a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown.This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein binds to fanconi anemia complementation group A protein, but its function is unknown. This gene results in two transcript variants encoding the same protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNX5

Key Reference: Wassmer,T., J. Cell. Sci. 120 (PT 1), 45-54 (2007)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: FVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Sorting nexin-5

Protein Size: 404

Purification: Affinity Purified

• Artikelnummer: AVIARP55050_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55050_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 27131
• Wirt: Rabbit