SOX15 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: SOX15 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SOX15

Key Reference: Yan,H.T., (2007) Mol. Cells 24 (3), 323-328

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: ALPGSSQDQAWSLEPPAATAAASSSSGPQEREGAGSPAAPGTLPLEKVKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein SOX-15

Protein Size: 233

Purification: Affinity Purified

• Artikelnummer: AVIARP57899_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57899_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6665
• Wirt: Rabbit