SPACA4 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: SPACA4 is a sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization.

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MHCGDDEDCFTGHGVAPGTGPVINKGCLRATSCGLEEPVSYRGVTYSLTT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sperm acrosome membrane-associated protein 4

Protein Size: 124

Purification: Affinity Purified

• Artikelnummer: AVIARP58662_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58662_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 171169
• Wirt: Rabbit
• Konjugat: Conjugated, HRP