SPART Antibody - middle region : Biotin

SPART Antibody - middle region : Biotin
Artikelnummer
AVIARP55162_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein containing a MIT (Microtubule Interacting and Trafficking molecule) domain, and is implicated in regulating endosomal trafficking and mitochondria function. The protein localizes to mitochondria and partially co-localizes with microtubules. Stimulation with epidermal growth factor (EGF) results in protein translocation to the plasma membrane, and the protein functions in the degradation and intracellular trafficking of EGF receptor. Multiple alternatively spliced variants, encoding the same protein, have been identified. Mutations associated with this gene cause autosomal recessive spastic paraplegia 20 (Troyer syndrome).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPG20

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: ASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: spartin

Protein Size: 666

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55162_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55162_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23111
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×