SPAST Antibody - middle region : FITC

SPAST Antibody - middle region : FITC
Artikelnummer
AVIARP57602_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the AAA (ATPases associated with a variety of cellular activities) protein family. Members of this protein family share an ATPase domain and have roles in diverse cellular processes including membrane trafficking, intracellular motility, organelle biogenesis, protein folding, and proteolysis. The encoded ATPase may be involved in the assembly or function of nuclear protein complexes. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described but their full length sequences have not been determined. Mutations associated with this gene cause the most frequent form of autosomal dominant spastic paraplegia 4.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SPAST

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: RVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spastin

Protein Size: 498

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57602_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57602_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6683
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×