SPATA2 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: SPATA2 may have a role in the regulation of spermatogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPATA2

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: DRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spermatogenesis-associated protein 2

Protein Size: 520

Purification: Affinity Purified

• Artikelnummer: AVIARP59150_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59150_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 9825
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin